Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein cornichon homolog 5(At4g12090)

Recombinant Arabidopsis thaliana Protein cornichon homolog 5(At4g12090)

SKU:CSB-CF890483DOA

Regular price $1,723.00 USD
Regular price Sale price $1,723.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SZ74

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGDLLDWIISFLFLATLIIIVIYQLTCLADLEFDRINPYDVSSRINRMVLPEFGLQGLLC LYYILTGHWFMAVLSLPHLFYNIRLYMKREHLADVTELYNTNKWEQKKRVYKIGHIALSI FITTYWLIHSALGDI

Protein Names:Recommended name: Protein cornichon homolog 5

Gene Names:Ordered Locus Names:At4g12090 ORF Names:F16J13.160

Expression Region:1-135

Sequence Info:full length protein

View full details