Recombinant Arabidopsis thaliana  Protein Asterix(At5g07960)

Recombinant Arabidopsis thaliana Protein Asterix(At5g07960)

CSB-CF890314DOA
Regular price
$1,073.00 USD
Sale price
$1,073.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SD88

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSHSHGNASSVNDPRQPSAAKPYIPRPVAPEDLPVDYSGFIAVILGVSGVMFRYKICSWL AIIFCAQSLANMRNLENDLKQISMAMMFAIMGLVTNYLGPNRPATKK

Protein Names:Recommended name: Protein Asterix

Gene Names:Ordered Locus Names:At5g07960 ORF Names:F13G24.160, MXM12.20

Expression Region:1-107

Sequence Info:full length protein

Your list is ready to share