Recombinant Arabidopsis thaliana Probable cytochrome c oxidase subunit 5C-3(At5g61310)

SKU: CSB-CF866973DOA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FLK2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGHKIAHATLKGPSVVKELVIGLTLGLAAGGLWKMHHWNEQRKTRVFYDLLERGEIGVV VTEE

Protein Names:Recommended name: Probable cytochrome c oxidase subunit 5C-3 Alternative name(s): Cytochrome c oxidase polypeptide Vc-3

Gene Names:Ordered Locus Names:At5g61310 ORF Names:FB13.8

Expression Region:1-64

Sequence Info:full length protein