Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O22912
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGHKVAHATLKGPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVV AAEE
Protein Names:Recommended name: Probable cytochrome c oxidase subunit 5C-1 Alternative name(s): Cytochrome c oxidase polypeptide Vc-1
Gene Names:Ordered Locus Names:At2g47380 ORF Names:T8I13.22
Expression Region:1-64
Sequence Info:full length protein