Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable cytochrome c oxidase subunit 5C-1 (At2g47380)

Recombinant Arabidopsis thaliana Probable cytochrome c oxidase subunit 5C-1 (At2g47380)

SKU:CSB-CF521259DOA

Regular price $1,490.00 USD
Regular price Sale price $1,490.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O22912

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGHKVAHATLKGPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVV AAEE

Protein Names:Recommended name: Probable cytochrome c oxidase subunit 5C-1 Alternative name(s): Cytochrome c oxidase polypeptide Vc-1

Gene Names:Ordered Locus Names:At2g47380 ORF Names:T8I13.22

Expression Region:1-64

Sequence Info:full length protein

View full details