Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable aquaporin PIP1-4(PIP1.4)

Recombinant Arabidopsis thaliana Probable aquaporin PIP1-4(PIP1.4)

SKU:CSB-CF653696DOA

Regular price $1,910.00 USD
Regular price Sale price $1,910.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q39196

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHGYTKGSGLG AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS LGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKSKS

Protein Names:Recommended name: Probable aquaporin PIP1-4 Alternative name(s): Plasma membrane intrinsic protein 1-4 Short name= AtPIP1;4 Transmembrane protein C Short name= TMP-C

Gene Names:Name:PIP1.4 Synonyms:TMPC Ordered Locus Names:At4g00430 ORF Names:A_IG005I10.2, F5I10.2

Expression Region:1-287

Sequence Info:full length protein

View full details