Recombinant Arabidopsis thaliana Photosystem I reaction center subunit V, chloroplastic(PSAG)

SKU: CSB-CF870999DOA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9S7N7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYVSLLK SNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGYDPSFFG

Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): PSI-G

Gene Names:Name:PSAG Ordered Locus Names:At1g55670 ORF Names:F20N2.21, F20N2.33, F20N2_3

Expression Region:61-160

Sequence Info:full length protein