Gene Bio Systems
Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3, chloroplastic-mitochondrial(OEP163)
Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3, chloroplastic-mitochondrial(OEP163)
SKU:CSB-CF524325DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O48528
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDPAEMRYLEEEDGPLMKTIKGSITGFGAGTIYGTILATWKDVPRVERNVALPGLIRTLK MMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRARSIPTAIAA GATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEADS
Protein Names:Recommended name: Outer envelope pore protein 16-3, chloroplastic/mitochondrial Alternative name(s): Chloroplastic outer envelope pore protein of 16 kDa 3 Short name= AtOEP16-3 Short name= OEP16-3
Gene Names:Name:OEP163 Ordered Locus Names:At2g42210 ORF Names:T24P15.12
Expression Region:1-159
Sequence Info:full length protein
