Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(At5g47570)

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(At5g47570)

SKU:CSB-CF861779DOA

Regular price $1,501.00 USD
Regular price Sale price $1,501.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FGK0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFF VGLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

Gene Names:Ordered Locus Names:At5g47570 ORF Names:MNJ7.16

Expression Region:30-125

Sequence Info:full length protein

View full details