Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-A (At2g02510)

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-A (At2g02510)

SKU:CSB-CF525359DOA

Regular price $1,646.00 USD
Regular price Sale price $1,646.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O64725

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKPLGTTGEFFRRRDEWRKHPMLSNQMRHALPGIGIGVGAFCVYLVGEQIYSKLMAPSS QSSHQKQPAPSH

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-A

Gene Names:Ordered Locus Names:At2g02510 ORF Names:T8K22.19

Expression Region:1-72

Sequence Info:full length protein

View full details