Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana HVA22-like protein e(HVA22E)

Recombinant Arabidopsis thaliana HVA22-like protein e(HVA22E)

SKU:CSB-CF875422DOA

Regular price $1,738.00 USD
Regular price Sale price $1,738.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FED2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKLWTSLSALHSLAGPVVMLLYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELIL QSLLEWIPIWYTAKLVFVAWLVLPQFRGAAFIYNKVVREQFKKYGILKPKVEHQAE

Protein Names:Recommended name: HVA22-like protein e Short name= AtHVA22e

Gene Names:Name:HVA22E Ordered Locus Names:At5g50720 ORF Names:MFB16.12

Expression Region:1-116

Sequence Info:full length protein

View full details