Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana ER lumen protein retaining receptor(ERD2)

Recombinant Arabidopsis thaliana ER lumen protein retaining receptor(ERD2)

SKU:CSB-CF333990DOA

Regular price $1,823.00 USD
Regular price Sale price $1,823.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P35402

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRFAGDMSHLISVLILLLKIYATKSCAGISLKTQELYALVFLTRYLDLFTDYVSLYN SIMKIVFIASSLAIVWCMRRHPLVRRSYDKDLDTFRHQYVVLACFVLGLILNEKFTVQEV FWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVVFLGAYRGLYIINWIYRYFTEDHFTR WIACVSGLVQTALYADFFYYYYISWKTNTKLKLPA

Protein Names:Recommended name: ER lumen protein retaining receptor Alternative name(s): HDEL receptor

Gene Names:Name:ERD2 Ordered Locus Names:At1g29330 ORF Names:F15D2.26, F28N24.1

Expression Region:1-215

Sequence Info:full length protein

View full details