Gene Bio Systems
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23(ATL23)
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23(ATL23)
SKU:CSB-CF813165DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8L9W3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHYTRISPALVPSLSPTAAAESSGGGTMIATVFMALLLPCVGMCIVFLIYLFLLWCSTRR RIERLRFAEPVKPVTGKGLSVLELEKIPKLTGRELAVIARSTECAVCLEDIESGQSTRLV PGCNHGFHQLCADTWLSNHTVCPVCRAELAPNLPQCNENQSPC
Protein Names:Recommended name: E3 ubiquitin-protein ligase ATL23 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein ATL23
Gene Names:Name:ATL23 Ordered Locus Names:At5g42200 ORF Names:MJC20.31
Expression Region:1-163
Sequence Info:full length protein
