Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Cytochrome c oxidase subunit 5C-2(At3g62400)

Recombinant Arabidopsis thaliana Cytochrome c oxidase subunit 5C-2(At3g62400)

SKU:CSB-CF885494DOA

Regular price $1,637.00 USD
Regular price Sale price $1,637.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LZQ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGHKVAHATLKGPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEIGVV ASEE

Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-2 Alternative name(s): Cytochrome c oxidase polypeptide Vc-2

Gene Names:Ordered Locus Names:At3g62400 ORF Names:T12C14_100

Expression Region:1-64

Sequence Info:full length protein

View full details