Gene Bio Systems
Recombinant Arabidopsis thaliana Cytochrome b5 isoform 1(At5g53560)
Recombinant Arabidopsis thaliana Cytochrome b5 isoform 1(At5g53560)
SKU:CSB-CF670355DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q42342
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFE DVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILI LGLALVVRHYTKKD
Protein Names:Recommended name: Cytochrome b5 isoform 1
Gene Names:Ordered Locus Names:At5g53560 ORF Names:MNC6.10
Expression Region:1-134
Sequence Info:full length protein
