Gene Bio Systems
Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic(CM1),partial
Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic(CM1),partial
SKU:CSB-RP134794Pl
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: P42738
Gene Names: APX1
Organism: Arabidopsis thaliana (Mouse-ear cress)
AA Sequence: ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA
Expression Region: 3-247aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 31.1 kDa
Alternative Name(s): CM-1
Relevance: May play a role in chloroplast biogenesis.Curated
Reference: Identification, characterization and comparative analysis of a novel chorismate mutase gene in Arabidopsis thaliana.Mobley E.M., Kunkel B.N., Keith B.Gene 240:115-123(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.