Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8VZ87
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 3, chloroplastic Alternative name(s): Chlorophyll a-b protein 180 Short name= CAB-180 LHCII type I CAB-3
Gene Names:Name:LHCB1.2 Synonyms:AB180, CAB3, LHCP-A Ordered Locus Names:At1g29910 ORF Names:F1N18.5
Expression Region:36-267
Sequence Info:full length protein