Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 2, chloroplastic(LHCB1.1)

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 2, chloroplastic(LHCB1.1)

SKU:CSB-CF316775DOA

Regular price $1,845.00 USD
Regular price Sale price $1,845.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P0CJ48

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 2, chloroplastic Alternative name(s): Chlorophyll a-b protein 165 Short name= CAB-165 LHCII type I CAB-2

Gene Names:Name:LHCB1.1 Synonyms:AB165, CAB2, LHCP-B Ordered Locus Names:At1g29920 ORF Names:F1N18.4

Expression Region:36-267

Sequence Info:full length protein

View full details