Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Casparian strip membrane protein 5(CASP5)

Recombinant Arabidopsis thaliana Casparian strip membrane protein 5(CASP5)

SKU:CSB-CF878625DOA

Regular price $1,787.00 USD
Regular price Sale price $1,787.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LXF3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSGQAEIMETSKGIQKSGLMSRRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQF IRFQAEYNDLPALTFFVVANAVVSGYLILSLTLAFVHIVKRKTQNTRILLIILDVAMLGL LTSGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAIVLLILLILLSA IALSRRH

Protein Names:Recommended name: Casparian strip membrane protein 5

Gene Names:Name:CASP5 Ordered Locus Names:At5g15290 ORF Names:F8M21_180

Expression Region:1-187

Sequence Info:full length protein

View full details