Gene Bio Systems
Recombinant Arabidopsis thaliana CASP-like protein At1g49405(At1g49405)
Recombinant Arabidopsis thaliana CASP-like protein At1g49405(At1g49405)
SKU:CSB-CF660368DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q3ECT8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVEVPGSVGTTASLSLRLGQMVLAFGSLLFMTIGVRFYQFTAFCYLVTIMSLAIPWNLTL AMVDIYCVILQQPFQKPRILLAISIGDWVVSVLALASASSAASVVDILRSNESSCPPTIC NRYQFAATLAFLTWFLSLSSSLFNLWLLPSLI
Protein Names:Recommended name: CASP-like protein At1g49405
Gene Names:Ordered Locus Names:At1g49405 ORF Names:F13F21.34
Expression Region:1-152
Sequence Info:full length protein
