Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET2(SWEET2)

Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET2(SWEET2)

SKU:CSB-CF873266DOA

Regular price $1,848.00 USD
Regular price Sale price $1,848.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LH79

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVFAFNASLSMCKDVAGIAGNIFAFGLFVSPMPTFRRIMRNKSTEQFSGLPYIYALLNC LICLWYGTPFISHSNAMLMTVNSVGATFQLCYIILFIMHTDKKNKMKMLGLLFVVFAVVG VIVAGSLQIPDQLTRWYFVGFLSCGSLVSMFASPLFVINLVIRTKSVEFMPFYLSLSTFL MSASFLLYGLFNSDAFVYTPNGIGTILGIVQLALYCYYHRNSIEEETKEPLIVSYV

Protein Names:Recommended name: Bidirectional sugar transporter SWEET2 Short name= AtSWEET2

Gene Names:Name:SWEET2 Ordered Locus Names:At3g14770 ORF Names:T21E2.2

Expression Region:1-236

Sequence Info:full length protein

View full details