Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin PIP2-2(PIP2-2)

Recombinant Arabidopsis thaliana Aquaporin PIP2-2(PIP2-2)

SKU:CSB-CF337371DOA

Regular price $1,907.00 USD
Regular price Sale price $1,907.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P43287

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYK IQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLI RAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVY TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSK PWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV

Protein Names:Recommended name: Aquaporin PIP2-2 Alternative name(s): Plasma membrane intrinsic protein 2-2 Short name= AtPIP2;2 Plasma membrane intrinsic protein 2b Short name= PIP2b TMP2b

Gene Names:Name:PIP2-2 Synonyms:PIP2B Ordered Locus Names:At2g37170 ORF Names:T2N18.7

Expression Region:2-285

Sequence Info:full length protein

View full details