Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin PIP2-1(PIP2-1)

Recombinant Arabidopsis thaliana Aquaporin PIP2-1(PIP2-1)

SKU:CSB-CF337370DOA

Regular price $1,910.00 USD
Regular price Sale price $1,910.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P43286

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKDVEAVPGEGFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLTVIG YKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS LPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGTFVL VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNK SKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV

Protein Names:Recommended name: Aquaporin PIP2-1 Alternative name(s): Plasma membrane intrinsic protein 2-1 Short name= AtPIP2;1 Plasma membrane intrinsic protein 2a Short name= PIP2a

Gene Names:Name:PIP2-1 Synonyms:PIP2A Ordered Locus Names:At3g53420 ORF Names:F4P12.120

Expression Region:2-287

Sequence Info:full length protein

View full details