Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_901635 (ARALYDRAFT_901635)

Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_901635 (ARALYDRAFT_901635)

SKU:CSB-CF522169DNZ

Regular price $1,828.00 USD
Regular price Sale price $1,828.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Uniprot NO.:D7LGW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIEKAASRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKVSAAGWKRGVA IFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQAEYTDLPTMSSFVIVNSIVGGY LTLSLPFSIVCILRPLAVPPRLFLIICDTAMMGLTMMAASASAAIVYLAHNGNSSSNWLP VCQQFGDFCQGTSGAVVASFIAATLLMFLVILSAFALKRST

Protein Names:Recommended name: Casparian strip membrane protein ARALYDRAFT_901635

Gene Names:ORF Names:ARALYDRAFT_901635

Expression Region:1-221

Sequence Info:full length protein

View full details