Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_495581 (ARALYDRAFT_495581)

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_495581 (ARALYDRAFT_495581)

SKU:CSB-CF518893DNZ

Regular price $1,796.00 USD
Regular price Sale price $1,796.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Uniprot NO.:D7MUY4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRANNNNTREEERSSSSKQQQPQAHMSLKIIDSCLRLSVVPLSVATIWLTVTNHESNPDY GNLDYNSIMGLKYMVGVSAISAIYALLSTISLWVTCLVSKAWLFFVPDQVLAYVMTTSVA GATEIVYLLNKGDKIVTWSEMCSSYPHYCSKLTIALGLHVFVLFFFLFLSVISAYRAFSP FDPPCDSQTNIDA

Protein Names:Recommended name: CASP-like protein ARALYDRAFT_495581

Gene Names:ORF Names:ARALYDRAFT_495581

Expression Region:1-193

Sequence Info:full length protein

View full details