Gene Bio Systems
Recombinant Aquifex aeolicus Uncharacterized protein aq_125 (aq_125)
Recombinant Aquifex aeolicus Uncharacterized protein aq_125 (aq_125)
SKU:CSB-CF530209DNV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aquifex aeolicus (strain VF5)
Uniprot NO.:O66525
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKEKLALALLSFFLGLGSFFSFYVAPTLFKVLERQQAGAVVEKVFPVYFGLGIILVGISL FLGRDSGKLFLSLGILNLLLLLLQEFIVIPKLHGLKATNYELFLKYHGVSMGINLAILLL TLGKVLILIFKR
Protein Names:Recommended name: Uncharacterized protein aq_125
Gene Names:Ordered Locus Names:aq_125
Expression Region:1-132
Sequence Info:full length protein
