Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aquareovirus G Non-structural protein 5(S7)

Recombinant Aquareovirus G Non-structural protein 5(S7)

SKU:CSB-CF456130DNU

Regular price $1,730.00 USD
Regular price Sale price $1,730.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aquareovirus G (isolate American grass carp/USA/PB01-155/-) (AQRV-G)

Uniprot NO.:B2BNE5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPCQDTVSLSIQHTHVIIQNSCCTTVSTSASTSATAYGLGCLALGCAGIAAAGICICCLI HGCPACPRRLGVRKQSSLSKQGHVSFHHLNPSDRVSRPYHPSCPTDVDLYLGGVQHDPDY VSHAQPIETQPQPLPPPPAYS

Protein Names:Recommended name: Non-structural protein 5 Short name= NS5 Alternative name(s): NS16

Gene Names:Name:S7

Expression Region:1-141

Sequence Info:full length protein

View full details