Recombinant Anemonia sulcata Delta-actitoxin-Avd1c

Recombinant Anemonia sulcata Delta-actitoxin-Avd1c

CSB-YP355673AKE
Regular price
$874.00 USD
Sale price
$874.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Anemonia sulcata (Mediterranean snakelocks sea anemone)

Delivery time: 3-7 business days

Uniprot ID: P01528

AA Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-47aa

Protein length: Full Length

MW: 6.9 kDa

Alternative Name(s): ATX-II

Relevance: Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM) (PubMed:15169781). It has also great activity on Nav1.5/SCN5A (EC(50)=49.05 nM), Nav1.4/SCN4A (EC(50)=109.49 nM) and Nav1.6/SCN8A (EC(50)=about 180 nM) and is less potent on Nav1.3/SCN3A (EC(50)=759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781).

Reference: "Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone."Hartung K., Rathmayer W.Pflugers Arch. 404:119-125(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share