Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK(psaK)

Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK(psaK)

SKU:CSB-CF334968BYN

Regular price $1,653.00 USD
Regular price Sale price $1,653.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Uniprot NO.:P23317

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AATTPLEWSPTIGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAF GHILGVGIILGLHNLGRF

Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 6.8 kDa polypeptide Photosystem I subunit X

Gene Names:Name:psaK Ordered Locus Names:Ava_2445

Expression Region:9-86

Sequence Info:full length protein

View full details