>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: algL
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Azotobacter vinelandii
Delivery time: 3-7 business days
Uniprot ID: O52195
AA Sequence: AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 24-374aa
Protein length: Full Length of Mature Protein
MW: 59 kDa
Alternative Name(s): Poly(beta-D-mannuronate) lyase
Relevance: Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space
Reference: "Biochemical properties and substrate specificities of a recombinantly produced Azotobacter vinelandii alginate lyase." Ertesvag H., Erlien F., Skjak-Braek G., Rehm B.H., Valla S. J. Bacteriol. 180:3779-3784(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.