Skip to product information
1 of 1

Gene Bio Systems

Recombinant Alcelaphine herpesvirus 1 Glycoprotein N(53)

Recombinant Alcelaphine herpesvirus 1 Glycoprotein N(53)

SKU:CSB-CF523608AZG

Regular price $1,504.00 USD
Regular price Sale price $1,504.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)

Uniprot NO.:O36403

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSTPRAVTHPVLNATSNFNPTAGFYSFSCNADTYLLRLNSFSSIWALMNVFVVLVSTVVF MTYLCFTKFVHTLIYQQK

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:Name:53

Expression Region:26-103

Sequence Info:full length protein

View full details