Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ajellomyces dermatitidis Protein GET1(GET1)

Recombinant Ajellomyces dermatitidis Protein GET1(GET1)

SKU:CSB-CF513628AZE

Regular price $1,809.00 USD
Regular price Sale price $1,809.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ajellomyces dermatitidis (strain SLH14081) (Blastomyces dermatitidis)

Uniprot NO.:C5JW43

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSLLITILLLNIVIYVINTIGAATIDSLLWLFYIKLPTGTSHMAREQRRLKREVIQLKR EMNATSSQDEFAKWAKLRRRHDKALETYEAKNNELTQCKSSFDMTVKSVRWAATSGLMLF LQFWYSKRPIFTLPPGWIPWQVQWVLSFPRAPMGTVSIQIWGGACATVVALVGDAVGATM GFVSASKKEGMKVGAGVGEKEGKKSQ

Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:GET1 ORF Names:BDBG_06196

Expression Region:1-206

Sequence Info:full length protein

View full details