Gene Bio Systems
Recombinant Ajellomyces dermatitidis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
Recombinant Ajellomyces dermatitidis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
SKU:CSB-CF511814AZD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis)
Uniprot NO.:C5GDJ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPNIDNTPLPSSFDAHPEFFQETKWQKVTRRLKEEPLIPIGYAATSYALWRAYKSMKARD SVELNRMFRARIYGHAFTLFAIVAGGIYYGQERKQRKEFEKALQEKQDQEKRDAWLRELE VRDKEDKDWRQRHAAMEMAAKEAEKKMG
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 ORF Names:BDCG_03143
Expression Region:1-148
Sequence Info:full length protein
