Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ajellomyces capsulata (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Uniprot NO.:A6R3V7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASRRSAAAKKEDFSFEAAATQSAHEAQEGFPSSVIIKLVLVTVAMICAPLGTYFGTLNT ICGGDSSYAGALAAISVNVVLIIYLIIAAREDTGESEEERKGKEGKEE
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:VMA21 ORF Names:HCAG_04315
Expression Region:1-108
Sequence Info:full length protein