Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ailuropoda melanoleuca UPF0767 protein C1orf212 homolog (PANDA_005386)

Recombinant Ailuropoda melanoleuca UPF0767 protein C1orf212 homolog (PANDA_005386)

SKU:CSB-CF509897AYX

Regular price $1,720.00 USD
Regular price Sale price $1,720.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ailuropoda melanoleuca (Giant panda)

Uniprot NO.:D2H617

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWPVLWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN

Protein Names:Recommended name: UPF0767 protein C1orf212 homolog

Gene Names:ORF Names:PANDA_005386

Expression Region:1-92

Sequence Info:full length protein

View full details