Skip to product information
1 of 1

Gene Bio Systems

Recombinant Agrobacterium tumefaciens UPF0314 protein Atu8092(Atu8092)

Recombinant Agrobacterium tumefaciens UPF0314 protein Atu8092(Atu8092)

SKU:CSB-CF851728AYS

Regular price $1,803.00 USD
Regular price Sale price $1,803.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Uniprot NO.:Q8U527

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTVAEMSASRSRSLRWFGVAAGLLLLQIVILYAMGRIPICECGYVKLFEPGVNTPGNSQH LADWYTPSHIIHGFLFYWFAWLLFRNKPFSMRLSFAVLIEAAWELLENSPIIIDRYRTAT TALGYTGDSILNSAMDTVFMALGFLFAARVPVWLTVVIAIFFEIFTGWLIRDNLTLNVVM LVWPVDVIKEWQNALPQM

Protein Names:Recommended name: UPF0314 protein Atu8092

Gene Names:Ordered Locus Names:Atu8092 ORF Names:AGR_C_4880, Atu2691.1

Expression Region:1-198

Sequence Info:full length protein

View full details