Recombinant Agrobacterium tumefaciens  Protein virB3(virB3)

Recombinant Agrobacterium tumefaciens Protein virB3(virB3)

CSB-CF363456AEZ
Regular price
$1,093.00 USD
Sale price
$1,093.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Agrobacterium tumefaciens (strain 15955)

Uniprot NO.:P0A3V9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARL IVERDYNAASVVLLFLRTAGRSIDSAVWGGATVSPNPIRVPPRGRGMV

Protein Names:Recommended name: Protein virB3

Gene Names:Name:virB3

Expression Region:1-108

Sequence Info:full length protein

Your list is ready to share