Recombinant African swine fever virus  Uncharacterized protein B117L (Pret-095)

Recombinant African swine fever virus Uncharacterized protein B117L (Pret-095)

CSB-CF317546AYG
Regular price
$1,095.00 USD
Sale price
$1,095.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)

Uniprot NO.:P0CA20

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGYTIQLDKDGDYCWDEDPTHHDPYTQANATSHTAVSRAAMAAPHAAAHHAFHEPFIKLN LTDKNIFNGLGFILIVIFIYLLLITLQQMLTRHIYNTVQHCVKAHLDSKNLQ

Protein Names:Recommended name: Uncharacterized protein B117L Short name= pB117L

Gene Names:Ordered Locus Names:Pret-095

Expression Region:1-112

Sequence Info:full length protein

Your list is ready to share