Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Uniprot NO.:P0C9J7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKAFLGFLLLSYLAIILVHDNVNCIIFGIFDPCFYKISSKISNDYSSMQCSHPISYIGYE MFIQKWKDDNYWPLIIRHCCFYLVFSIAFASCVAFAIRRNLHLSTTMKLLGLLSILVWLA QPVLNQPFPT
Protein Names:Recommended name: Protein MGF 360-1L
Gene Names:Ordered Locus Names:Pret-023
Expression Region:1-130
Sequence Info:full length protein