Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Protein MGF 110-13L (Mal-018)

Recombinant African swine fever virus Protein MGF 110-13L (Mal-018)

SKU:CSB-CF316362AYE

Regular price $1,793.00 USD
Regular price Sale price $1,793.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Uniprot NO.:P0C9K1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGGGGDHQQLSIKQYCLYFIIGIAYTDCFICALCKNLRLSTTMKLFVLLSILVWLAQPVL NRPLSIFYTKQILPRTYTPPMRELEYWCTYGKHCDFCWDCKNGICKNKVLDDMPLIVQND YISKCSITRFIDRCMYFIEPKIPYIHYMNCSLPTYFS

Protein Names:Recommended name: Protein MGF 110-13L

Gene Names:Ordered Locus Names:Mal-018

Expression Region:1-157

Sequence Info:full length protein

View full details