Gene Bio Systems
Recombinant African swine fever virus Major structural protein p17(Ba71V-107)
Recombinant African swine fever virus Major structural protein p17(Ba71V-107)
SKU:CSB-CF806121AEJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Uniprot NO.:Q89424
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYY NRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS
Protein Names:Recommended name: Major structural protein p17
Gene Names:Ordered Locus Names:Ba71V-107 ORF Names:D117L
Expression Region:1-117
Sequence Info:full length protein
