GeneBio Systems
Recombinant African swine fever virus Inner membrane protein p54 (p54), partial
Recombinant African swine fever virus Inner membrane protein p54 (p54), partial
SKU:B2MUM6
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: B2MUM6
Gene Names: p54
Alternative Name(s):
Abbreviation: Recombinant African swine fever virus Inner membrane protein p54, partial
Organism: African swine fever virus (ASFV)
Source: E.coli
Expression Region: 53-184aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: SSRKKKAAAIEEEDIQFINPYQDQQWVEVTPQPGTSKPAGATTASVGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAPAHPAEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSL
MW: 16.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā/-80ā. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā/-80ā. The shelf life of lyophilized form is 12 months at -20ā/-80ā.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
Relevance: Regulates cell proliferation through the inhibition of cell cycle arrest at the G1 phase. Also negatively regulates p53-mediated apoptosis.
Reference:
Function:
