Skip to product information
1 of 1

GeneBio Systems

Recombinant African swine fever virus Inner membrane protein p54 (Ba71V-126), partial

Recombinant African swine fever virus Inner membrane protein p54 (Ba71V-126), partial

SKU:Q65194

Regular price $1,068.00 USD
Regular price Sale price $1,068.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q65194

Gene Names: Ba71V-126

Alternative Name(s): (pE183L)

Abbreviation: Recombinant African swine fever virus Ba71V-126 protein, partial

Organism: African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Source: E.coli

Expression Region: 54-183aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSL

MW: 17.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inner envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis. Plays a role in virion morphogenesis by recruiting and transforming the host ER membranes into the precursors of the viral envelope. Involved in virus attachment to the host cell.

Reference: "The African swine fever virus dynein-binding protein p54 induces infected cell apoptosis." Hernaez B., Diaz-Gil G., Garcia-Gallo M., Ignacio Quetglas J., Rodriguez-Crespo I., Dixon L., Escribano J.M., Alonso C. FEBS Lett. 569: 224-228(2004)

Function:

View full details