Gene Bio Systems
Recombinant Aeropyrum pernix UPF0290 protein APE_0433(APE_0433)
Recombinant Aeropyrum pernix UPF0290 protein APE_0433(APE_0433)
SKU:CSB-CF896629AYB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Uniprot NO.:Q9YF05
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALELAVDWRIDNILEAIILMLPAMIANATPVVAGGRRPVDMGVVLPDGRRLLGDGKTIE GLLAGFAAGSAAGVLAALASGNMLLAVHSPAIALGALAGDMAGSFVKRRLGIERGRPAPL LDQLDFYLGALAVSIALGYTWTPRVAVEAAAAVLLLHLAANITAYLLGLKKVPW
Protein Names:Recommended name: UPF0290 protein APE_0433
Gene Names:Ordered Locus Names:APE_0433
Expression Region:1-174
Sequence Info:full length protein
