Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aeropyrum pernix Heme-copper oxidase subunit 4(aoxC)

Recombinant Aeropyrum pernix Heme-copper oxidase subunit 4(aoxC)

SKU:CSB-CF897389AYB

Regular price $1,685.00 USD
Regular price Sale price $1,685.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)

Uniprot NO.:Q9YDX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASGGGFEDLAREAAKYFGVWIVLVASAVAEVYLVLEGIARNPFVFVLAVALFQSSLIAL FFQHLRDEPIIIRGITVSGAVLIAILIISAVTSVLTCTPYFPG

Protein Names:Recommended name: Heme-copper oxidase subunit 4 EC= 1.9.3.- Alternative name(s): Heme-copper oxidase subunit IV

Gene Names:Name:aoxC Ordered Locus Names:APE_0795.1

Expression Region:1-103

Sequence Info:full length protein

View full details