Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aedes aegypti UPF0443 protein AAEL005900(AAEL005900)

Recombinant Aedes aegypti UPF0443 protein AAEL005900(AAEL005900)

SKU:CSB-CF612548AXQ

Regular price $1,481.00 USD
Regular price Sale price $1,481.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Uniprot NO.:Q0IFA9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKLRGGQTKETRKQKQERREENLKIQQQLKTIVLPICGVFLMCIVVYVFLKTRPRFEEL

Protein Names:Recommended name: UPF0443 protein AAEL005900

Gene Names:ORF Names:AAEL005900

Expression Region:1-60

Sequence Info:full length protein

View full details