Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acinetobacter baumannii Protein CrcB homolog(crcB)

Recombinant Acinetobacter baumannii Protein CrcB homolog(crcB)

SKU:CSB-CF450438AWO

Regular price $1,713.00 USD
Regular price Sale price $1,713.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acinetobacter baumannii (strain ACICU)

Uniprot NO.:B2I2S5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYYPLLSIALGSVLGAWLRWLLGLKLNPIYPQIPLGTVTVNLAGGFIIGFAMAYFAHSDL SPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISIHLIGSLIFTCLGLATY YWVAGN

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:ACICU_00398

Expression Region:1-126

Sequence Info:full length protein

View full details