Recombinant Acidovorax sp. UPF0391 membrane protein Ajs_0703 (Ajs_0703)

CSB-CF380367AUC

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acidovorax sp. (strain JS42)

Uniprot NO.:A1W3X2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKYAIIFAIISLIAGALGFTGVAAGSAAIAKVLFVVFLVLAVLFVVLALLGIGAARKAI K

Protein Names:Recommended name: UPF0391 membrane protein Ajs_0703

Gene Names:Ordered Locus Names:Ajs_0703

Expression Region:1-61

Sequence Info:full length protein