
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidovorax sp. (strain JS42)
Uniprot NO.:A1W4M2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFEDARMKFDVR YYLVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:Ajs_0957
Expression Region:1-119
Sequence Info:full length protein
You may also like
-
Recombinant Acidovorax citrulli NADH-quinone oxidoreductase subunit A(nuoA)
- Regular price
- $1,561.00 USD
- Sale price
- $1,561.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant NADH-quinone oxidoreductase subunit A(nuoA)
- Regular price
- $1,588.00 USD
- Sale price
- $1,588.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acidovorax citrulli NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- $1,542.00 USD
- Sale price
- $1,542.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant NADH-quinone oxidoreductase subunit A(nuoA)
- Regular price
- $1,592.00 USD
- Sale price
- $1,592.00 USD
- Regular price
-
- Unit price
- per
Sold out