
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670)
Uniprot NO.:C1F686
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKYLWVALGGALGALARYTVGVWIYERLGTRFPYGTFAINVTGCFLIGLALTVLDAHMDL SPAWRLAIPTGFIGAYTTFSTFEYETLRAAQHGQMGTAVLYFGSSLALGILAVWLGMVVG NRIVA
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:ACP_3316
Expression Region:1-125
Sequence Info:full length protein