Gene Bio Systems
Recombinant Acidianus filamentous virus 1 Putative transmembrane protein ORF108(ORF108)
Recombinant Acidianus filamentous virus 1 Putative transmembrane protein ORF108(ORF108)
SKU:CSB-CF744451AFAE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidianus filamentous virus 1 (isolate United States/Yellowstone) (AFV-1)
Uniprot NO.:Q70LB2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEQRFTHEDRFIMGLFPLLAVILISSNSSIIDIAMTVIIFGWIIYETLITVHFCKNYIET VESIMLGFVGFLGVLCLDKFPFGIILLIIYVIEGIYINVKTLKYARSC
Protein Names:Recommended name: Putative transmembrane protein ORF108
Gene Names:ORF Names:ORF108
Expression Region:1-108
Sequence Info:full length protein
